Olympicweightsetreview.com belongs to UNIFIEDLAYER-AS-1 - Unified Layer, US. Check the list of other websites hosted by UNIFIEDLAYER-AS-1 - Unified Layer, US.
In terms of rank-to-traffic ratio, olympicweightsetreview.com has 1,534 unique users per day, viewing 3,099 pages. The rank based value of olympicweightsetreview.com is 2,333 USD. Every user makes 2.16 pageviews on average.
Olympicweightsetreview.com boasts a link base consisting of 257 referring domains and 362 external backlinks, as revealed by the data obtained from web network scanning.
Olympicweightsetreview.com top-level domain belongs to .COM domain zone. Check other webpages in .COM zone.
According the last verification test in May 06, 2023, olympicweightsetreview.com has an expired SSL certificate issued by Let's Encrypt (expired on July 05, 2023). Click button “Update” SSL Information at the Safety Information section. Check the list of websites using SSL by Let's Encrypt.
Based on data from Google Safe Browsing and Symantec olympicweightsetreview.com is a fairly safe domain.
Based on Mobile-Friendly test by Google olympicweightsetreview.com is poorly optimized for mobile phones and tablets. Remember that optimizing your website design for mobile devices ensures that all of your web pages perform well on all devices, page loading speed can also be accelerated.
Domain | autodiscover.catdandruffclinic.com |
Issuer Organization | Let's Encrypt |
Issuer | R3 |
Algorithm | RSA-SHA256 |
Valid form | 04/06/2023 |
Expiration | 07/05/2023 |
Signed | Certificate is not self signed |
Additional Domains |
autodiscover.catdandruffclinic.com autodiscover.olympicweightsetreview.com catdandruffclinic.afteralayoff.com catdandruffclinic.com cpanel.catdandruffclinic.com cpanel.olympicweightsetreview.com cpcalendars.catdandruffclinic.com cpcalendars.olympicweightsetreview.com cpcontacts.catdandruffclinic.com cpcontacts.olympicweightsetreview.com mail.catdandruffclinic.com mail.olympicweightsetreview.com olympicweightsetreview.afteralayoff.com olympicweightsetreview.com webdisk.catdandruffclinic.com webdisk.olympicweightsetreview.com webmail.catdandruffclinic.com webmail.olympicweightsetreview.com www.catdandruffclinic.afteralayoff.com www.catdandruffclinic.com www.olympicweightsetreview.afteralayoff.com www.olympicweightsetreview.com |
Alexa Rank shows how popular olympicweightsetreview.com is in comparison with other sites. The most popular site has Alexa Rank equals 1. If olympicweightsetreview.com has Alexa Rank equals 100,000, then it is in TOP 100,000 popular sites in the world. The rank is calculated using a combination of average daily visitors to olympicweightsetreview.com and pageviews on olympicweightsetreview.com over the past 3 months.
ASN ID: 46606
ASN Title: UNIFIEDLAYER-AS-1 - Unified Layer, USLast Update: 06/01/2025
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
ASNumber: 46606
ASName: UNIFIEDLAYER-AS-1
ASHandle: AS46606
RegDate: 2008-10-24
Updated: 2016-11-08
Ref: https://rdap.arin.net/registry/autnum/46606
OrgName: Unified Layer
OrgId: BLUEH-2
Address: 1958 South 950 East
City: Provo
StateProv: UT
PostalCode: 84606
Country: US
RegDate: 2006-08-08
Updated: 2017-07-31
Ref: https://rdap.arin.net/registry/entity/BLUEH-2
ReferralServer: rwhois://rwhois.unifiedlayer.com:4321
OrgAbuseHandle: ABUSE3581-ARIN
OrgAbuseName: Abuse Department
OrgAbusePhone: +1-888-401-4678
OrgAbuseEmail: abuse@unifiedlayer.com
OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3581-ARIN
OrgTechHandle: NETWO5508-ARIN
OrgTechName: Network Operations
OrgTechPhone: +1-888-401-4678
OrgTechEmail: netops@unifiedlayer.com
OrgTechRef: https://rdap.arin.net/registry/entity/NETWO5508-ARIN
OrgNOCHandle: NETWO5508-ARIN
OrgNOCName: Network Operations
OrgNOCPhone: +1-888-401-4678
OrgNOCEmail: netops@unifiedlayer.com
OrgNOCRef: https://rdap.arin.net/registry/entity/NETWO5508-ARIN
RTechHandle: NETWO5508-ARIN
RTechName: Network Operations
RTechPhone: +1-888-401-4678
RTechEmail: netops@unifiedlayer.com
RTechRef: https://rdap.arin.net/registry/entity/NETWO5508-ARIN
RAbuseHandle: ABUSE3581-ARIN
RAbuseName: Abuse Department
RAbusePhone: +1-888-401-4678
RAbuseEmail: abuse@unifiedlayer.com
RAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3581-ARIN
RNOCHandle: NETWO5508-ARIN
RNOCName: Network Operations
RNOCPhone: +1-888-401-4678
RNOCEmail: netops@unifiedlayer.com
RNOCRef: https://rdap.arin.net/registry/entity/NETWO5508-ARIN
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
%rwhois V-1.5:000080:00 rwhois.unifiedlayer.com (by Unified Layer, V-1.0.0)
%error 230 No Objects Found
Domain Name: OLYMPICWEIGHTSETREVIEW.COM
Registry Domain ID: 1802313402_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2022-05-06T11:47:15Z
Creation Date: 2013-05-19T03:54:02Z
Registry Expiry Date: 2023-05-19T03:54:02Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BLUEHOST.COM
Name Server: NS2.BLUEHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-08-21T20:59:42Z
Host | A Record | TTL |
---|
Host | MX Record | Priority | TTL |
---|
Host | NS Record | TTL |
---|
Host | TXT Record | TTL |
---|